PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim04g070960.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 268aa    MW: 30425.2 Da    PI: 4.5712
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim04g070960.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.33.4e-382180362
              zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                        e+a +cprC stntkfCyynnyslsqPryfCkaCrryWtkGG+lrnvPvGgg+rk+++s+
  Sopim04g070960.0.1 21 EQAPNCPRCASTNTKFCYYNNYSLSQPRYFCKACRRYWTKGGSLRNVPVGGGCRKSRRSR 80
                        67789***************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-28873IPR003851Zinc finger, Dof-type
PfamPF027011.5E-322278IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.6862478IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102662IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MLPYHPRPMI MMERTRKSNI EQAPNCPRCA STNTKFCYYN NYSLSQPRYF CKACRRYWTK  60
GGSLRNVPVG GGCRKSRRSR STRKDDNTLQ TSSPALEGAP GAHDIDLADV FAKYLNQGTN  120
NDHDDNIIIQ ESQDYSSIGA SLSNSPSSDS LVNNPTSFEN ESLLDNFQDY PCGNFLQEEQ  180
GAQINQDFLD FNASFLEMQA ILGQEEDQFD HYNTSNFEWQ PMMQFQDFGS ILELDDHQLT  240
KNSTTNLASH DNNNNNNYSS FDLSNYI*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00405DAPTransfer from AT3G52440Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755160.0HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004238480.10.0PREDICTED: dof zinc finger protein DOF2.5
SwissprotQ9SVC52e-43DOF35_ARATH; Dof zinc finger protein DOF3.5
TrEMBLK4BT880.0K4BT88_SOLLC; Uncharacterized protein
STRINGSolyc04g070960.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.12e-37Dof family protein